PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_19703_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 263aa    MW: 29738.3 Da    PI: 7.9242
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_19703_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.2e-181964148
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                         rg++++eE++ +++++  lG++ W+tIa +++ gRt++++k++w+++l
  cra_locus_19703_iso_3_len_787_ver_3 19 RGKFSPEEEQTILNLHSVLGNK-WSTIATHLP-GRTDNEIKNFWNTHL 64
                                         89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500903.938113IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.2E-9224IPR009057Homeodomain-like
SuperFamilySSF466892.13E-21270IPR009057Homeodomain-like
PROSITE profilePS5129427.3761468IPR017930Myb domain
SMARTSM007172.6E-161866IPR001005SANT/Myb domain
PfamPF002492.0E-161964IPR001005SANT/Myb domain
CDDcd001671.07E-122164No hitNo description
Gene3DG3DSA:1.10.10.601.2E-232568IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
XGKSCRLRWT NYLRPDIKRG KFSPEEEQTI LNLHSVLGNK WSTIATHLPG RTDNEIKNFW  60
NTHLKKKLIQ NGIDPITHRP APPTATTWPH LIALSSNLND IIQQYSLQKQ MAANLQYYLQ  120
YLLQPPPPPP LLLEPSNMPP ATSSSYNNNI IVNYQEQKQQ QQQLDDHQMI PFSHLPHLQL  180
IPPCNFHDSS SPSSSASSLN KDILMILMNN NNNNNLEASS SDHHHHHPWL PPAPHHSSLS  240
PSTAALPTHV SHQLPIQEVA ATL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-1926842108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010027860.16e-63PREDICTED: transcription factor MYB34-like
TrEMBLA0A059AKZ87e-63A0A059AKZ8_EUCGR; Uncharacterized protein
STRINGPOPTR_0007s05360.11e-59(Populus trichocarpa)